Login

Your Name:(required)

Your Password:(required)

Join Us

Your Name:(required)

Your Email:(required)

Your Message :

Bioengineered elastin- and silk-biomaterials for drug and ...

Author: Minnie

Jul. 02, 2024

274 0 0

Bioengineered elastin- and silk-biomaterials for drug and ...

Are you interested in learning more about elastin peptide manufacturers? Contact us today to secure an expert consultation!

Abstract

Advances in medical science have led to diverse new therapeutic modalities, as well as enhanced understanding of the progression of various disease states. These findings facilitate the design and development of more customized and exquisite drug delivery systems that aim to improve therapeutic indices of drugs to treat a variety of conditions. Synthetic polymer-based drug carriers have often been the focus of such research. However, these structures suffer from challenges with heterogeneity of the starting material, limited chemical features, complex functionalization methods, and in some cases a lack of biocompatibility. Consequently, protein-based polymers have garnered much attention in recent years due to their monodisperse features, ease of production and functionalization, and biocompatibility. Genetic engineering techniques enable the advancement of protein-based drug delivery systems with finely tuned physicochemical properties, and thus an expanded level of customization unavailable with synthetic polymers. Of these genetically engineered proteins, elastin-like proteins (ELP), silk-like proteins (SLP), and silk-elastin-like proteins (SELP) provide a unique set of alternatives for designing drug delivery systems due to their inherent chemical and physical properties and ease of engineering afforded by recombinant DNA technologies. In this review we examine the advantages of genetically engineered drug delivery systems with emphasis on ELP and SLP constructions. Methods for fabrication and relevant biomedical applications will also be discussed.

Keywords:

Recombinant protein, Genetic engineering, Silk-like proteins, Elastin-like proteins, Drug delivery, Gene delivery

Graphical Abstrct

1.'Introduction

Natural and synthetic drugs have been used for centuries to treat health disorders and prolong lives. Unfortunately, many drugs have serious side effects because of their inherent toxicity and absence of specificity, which leads to harm to healthy organs and tissues. Such side effects limit the ability to create optimal treatments for many diseases such as cancers, neurodegenerative diseases, and infectious diseases. To circumvent these issues, research has focused on the development of efficient drug delivery systems (DDS). Such systems can help regulate the drug release rate, as well as the location of release, thereby improving therapeutic outcomes and reducing toxicity, and may also involve enhancing hydrophilicity, extending circulation times, and protecting the drug from undesired degradation [1]. The stability and chemical compositions of polymers make them great candidates for DDS. Fabrication formats (e.g., films and hydrogels) also improve utility of polymer-based systems. For example, the high stability and tunability of polymeric particles make them great candidate for drug delivery as they have good biocompatibility and can be functionalized for active or passive targeted therapy, while properties of hydrogels such as their high swelling ratio, their porosity and their soft consistency mimicking natural living tissue make them ideal candidates for the use in tissue engineering [2-6]. For this reason, various synthetic polymers such as polyesters, polyorthoesters, polyphosphoesters, and polyanhydrides have been utilized for the delivery of therapeutics. However, these systems can present significant challenges in terms of polymer heterogeneity, biocompatibility, bulk hydrolysis, and acidic degradation products, and often require additional processing and purification for utility in DDS [7]. Consequently, research focused on natural polymers such as silk fibroin, albumin, and alginate has been of interest to overcome the above limitations [8-12].

In contrast to synthetic polymers, protein-based polymers consisting of repetitive natural or engineered amino acid sequences, have advantages of homogeneity when generated via genetic engineering, biocompatibility, biodegradability without acidic degradation products, surface degradation due to enzymatic processes, aqueous and ambient processing of materials into delivery vehicles, and relative ease of scale-up and processing ( ) [7,13-17]. Additionally, as drugs become more complex and diverse, the control of drug delivery and release profiles becomes more demanding [1]. Thus, the properties necessary to match drug delivery demands require a level of customization that has not been attainable using synthetic polymer DDS [1,18]. The development of bioengineering methods facilitates the design and fabrication of biocompatible, responsive, and multi-faceted DDS ( - ). First, genetic engineering enables control of sequence, protein size, and homogeneity (theoretically, a polydispersity of one), thus, enabling more precise control of DDS assembly with material functions accurately tuned and controlled. This aids in the production of new tailor-made polymeric biomaterials with improved properties for specific biomedical needs [1,19-21]. Moreover, when recombinant protein polymers are synthesized in a biological system, such as bacteria, the final isolated protein is homogeneous with little variability in sequence, composition, or size, which improves batch-to-batch reproducibility for the pharmaceutical industry [1,21,22]. At the same time, unwanted bacterial remnants must be removed that can otherwise result in inflammatory reactions, such as LPS, which can increase the cost of production [23-25]. Protein-based materials are biodegradable and can be modified so degradation rates match the specific application [1,21]. Another advantage in the use of recombinant proteins is the ability to combine various domains (e.g., amino acid sequence modules) to generate libraries differing in amino acid composition more precise control of structure'function relationships [1,21,22]. The use of biopolymer derived constructions further facilitates tailoring of the final DDS to include stimuli-responsive features, tissue targeting components, and selective release properties, all of which enhance the selectivity, specificity, and therapeutic index of the drug being delivered. The potential to effectively modify sequence elements within the protein, and thus the resulting structure and function, lends protein-based DDS to many diverse therapeutic applications, including the delivery of small molecule drugs and biologics, as well as gene therapies and related topics. Finally, the lower costs of larger-scale production in biological systems render recombinant protein polymers amenable to process scale-up. Industry favors recombinant protein expression systems that have a successful track record, in particular Chinese Hamster Ovarian (CHO) cells and Escherichia coli, usually with three goals: high quality, high yield, and low cost [26]. Although mammalian cells are favored for the production of complex proteins, prokaryotic cells are easier to handle and less expensive in terms of media requirements and for scale-up [27,28]. The development of efficient bioprocessing strategies is crucial for industrial production of recombinant proteins of therapeutic importance. Recent advances have been made in bioprocessing, including the use of high-throughput devices and of disposable systems, continuous upstream processing, continuous chromatography, integrated continuous bioprocessing and process analytical technologies to achieve quality products with higher yields [28].

Open in a separate window

Table 1.

ELASTIN LIKE PROTEINSILK LIKE PROTEIN
  • Inverse temperature transition behavior

  • Elasticity

  • Amphiphilic, self-assembly behavior

  • Stabilization by physical crosslinks

  • Higher Mechanical Strength (robustness)

COMMON ADVANTAGES
  • Biodegradable with controlled rates of degradation by enzymes

  • Biocompatible

  • Tunable chemistry and material properties

  • Tight control of sequence and size; homogeneity in polymers and materials

  • Tailorable drug loading and release kinetics

  • Relatively low cost production and scale up

Open in a separate window

As a result, the interest and implementation of recombinant protein-based biopolymers for drug delivery has increased in recent years, with examples focused on the use of silk-like (SLP), silk-elastin-like (SELP), and elastin-like protein (ELP) polymers as delivery systems. In this review, we will discuss genetically engineered ELPs, and SLPs for the development of biopolymer-based DDS. Modifications to the original sequence, formulations, and current biomedical applications of these biomaterials will be reviewed, with emphasis on drug delivery.

2.'Engineered Proteins

2.1. Silkworm silk-like-protein recombinant protein polymers.

Silks are naturally produced proteins, characterized as block copolymers with highly conserved repeats of short side-chain amino acids as hydrophobic blocks and short sequences of larger side-chain or charged amino acids as hydrophilic blocks [29-32]. Silk fibroin sequences derived from the cocoons of silkworm Bombyx mori are one the most studied recombinant sources of silk. Silk fibroin contains a heavy chain composed of glycine (G) and alanine (A) rich sequences of hexapeptides including: GAGAGS, GAGAGY, GAGAGA, or GAGYGA, where S is serine and Y is tyrosine. Additionally, domains based on the Anaphe panda silkworm silk utilize repeats of (AAG)6 or (AG)9 as their hydrophobic sequences [1,29,33-35].

One of the main features of silk proteins is the capability to self-assemble, due to the amphiphilic nature of the sequences, to form different structures. The self-assembly of SLPs into nanoparticles has for drug delivery is directly linked to the secondary structure. The secondary structure of silks allows SLPs to be produced to meet specific characteristics of solubility, mechanical strength, biodegradation rate, as well as drug release kinetics, and can be predesigned into the sequence [1].

Recombinant expression of SLPs for different applications, has been extensively reported in different hosts. Transgenic B. mori silkworms have been modified to produce full length silk fibroin with peptide fusions [33,36-38]. While transgenic species offer a unique approach to modifying protein structure and function, there are many drawbacks to harvesting from natural biomaterial sources, including impurities, batch-to-batch variation, or increased immune response [39]. To overcome these issues, SLPs expression and purification from bacterial sources has been optimized over the years, resulting in production levels of 500 mg/L in batch cultures and up to 12.8 g/L in fed-batch systems [34,40-45]. These examples demonstrate how scale up production can be used to increase the yield of recombinant SLPs for use in DDS, with the benefit to tight control of the protein polymer versus the use of naturally-derived silk proteins from B. mori.

A major modification to silk sequences used in the design of DDS has been the addition of cell-binding motifs. Many peptides from extracellular matrix (ECM) proteins have been added to full length and core peptide sequences of silks in SLPs, such as RGD (i.e. arginine-glycine-aspartic acid) or fibronectin (GAAVTGRGDSPASAAGYI) [34,36,40-42]. The main modification related to drug delivery applications is the addition of elastin domains to generate silk-elastin-like-proteins (SELPs). SELPs consist of blocks from the silkworm silk sequence [GAGAGS]n and mammalian tropoelastin sequence [GVGVP]n exploiting specific physicomechanical properties of each sequence. The silk-like block, from the core B. mori silk heavy chain sequence, tends to self-assemble into insoluble tightly packed secondary structures, β-sheets (crystals), to provide thermal and chemical stability, mechanical tunability and physical crosslinking sites for the SELP polymeric systems [21,32,46,47]. The elastin-like block undergoes reversible structural transitions upon exposure to specific environmental stimuli, providing dynamic functions to the SELPs [46-49]. The most attractive features of SELPs for drug delivery comes from the biological and physicochemical properties, which can be tuned by: 1) varying the silk-elastin ratio; 2) modifying the second residue in the elastin sequence; 3) modifying the molecular weight; and 4) adding peptides to expand functions [1,19,33,42,46,49-52]. By varying the silk-elastin ratio, the thermal responsive properties can be tuned, where an increase in the silk-elastin ratio leads to a higher inverse temperature transition (Tt) [47]. By modifying the hydrophobicity of the second residue in the elastin block, SELPs become further responsive to various stimuli including temperature, pH, ionic strength, redox, enzymes and electric fields ( ) [53]. Finally, the inverse transition temperature is inversely correlated with the molecular weight [54].

Table 2.

Second residue in elastin block
G

X

GVPStimuliRef.Val, Phe, Ile, Tyr, GlyTemperature Ionic strength[46,47,53,54]Glu, LyspH Electrical field[53,54]CysRedox[51,53]RGYSLGPhospho/dephosphorylation[53]Open in a separate window

2.2. Spider silk-like-proteins recombinant protein polymers.

The other extensively studied source of silk is from spiders. The suborder Araneomorphea produce orb webs, which function as an extension of their sensory system, catching prey and providing protection [55-58]. These species produce at least 7 different kinds of silk by specialized glands in the spider abdomen.

Dragline silk has attracted attention due to its impressive mechanical properties and promising use in DDS. Spider dragline silk consists mainly of two high molecular weight proteins that exhibit a periodic pattern [56,58,59]. Most DDS based on spider silks have focused on the major ampullate gland silks from Nephila clavipes spiders (MaSp1 and MaSp2) and Araneus diadematus (ADF4, ADF3) [56,59-61]. A specific feature of the repeats in these spidroins is the hydrophobic poly-Ala (poly-A) domain consisting of 4 to 9 amino acid residues and a more hydrophilic Gly-enriched domain with GGX motifs for MaSp1 and GPGXX for MaSp2. Constructions mimicking the dragline core sequences from both MaSp and ADF have been studied as DDS using individual versions [19,62-64] or mixtures of spidroins [65]. Other DDS studies have also used other types of spider silks, including aciniform [50] and tubuliform [66].

The repetitive nature of the spider silk sequences, as well as the length, makes production and high yields in heterological expression systems challenging [56,58,60,67]. Spider silk expression in bacteria (E. coli), yeast Pichia pastoris [68] or Sacharomyces cerevisiae [69], animal cells [70], transgenic goats producing the proteins in their milk [71], plants (e.g. potato or tobacco), [72] or transgenic silkworms [52,73] have all been reported. Metabolically engineered E. coli generated the best yields, where the glycyl-tRNA pool was elevated [74,75].

An additional advantage of recombinant approaches to DDS is engineering in modifications to provide new properties to the recombinant proteins. An example is the addition of a glutamic acid to a silk variant based on core sequence of the MaSp2 protein from the spider N. clavipes; to modulate affinity of the engineered silk for drugs [76]. Another example demonstrated that engineering eADF4(C16) to incorporate a cysteine allowed the covalent coupling of peptides, enzymes or particles to the spider silk variant related to DDS [77]. Further modifications to eADF4(C16), replacing the negatively charged amino acids (glutamic acids) with positively charged amino acids (lysines), supported the sequestration of negatively charged, high-molecular-weight payloads, such as nucleic acids, and low-molecular-weight compounds [78]. Site specific modification with the replacement of methionine by L-azidohomoalanine (L-Aha) at the C-terminus of 4RepCT supported the chemical conjugation of different ligands (e.g., antibiotics, fluorophores) [79].

A critical challenge to efficacy of cancer chemotherapy concerns insufficient intracellular drug release. To improve cellular uptake and release, recombinant spider silk analogs were engineered to harbor poly-lysine/poly-arginine and cell penetrating peptides (CPPs) such as the Tat peptide (RKKRRQRRR) or the cell membrane-destabilizing peptide ppTG1 (GLFKALLKLLKSLWKLLLKA) [32,80-83]. Coupling peptides to poly-lysine variants ECM proteins (e.g. RGD or IKVAV) further improved cellular uptake by enhancing adhesion of the spider silk recombinant analogs to cells [83,84]. Although the CPPs facilitate cellular internalization, they lack cell specificity. To achieve greater selectivity, peptides that recognize cell surface features can be fused to the silk; such as to target specific cancer cells. The F3 tumor-homing peptide (KDEPQRRSARLSAKPAPPKPEPKPKKAPAKK) binds specifically to nucleoin, expressed on the surface of some tumor cells, and the CGKRK peptide to heparan sulfate present in tumor vessels. Both peptides were successfully fused to a silk protein functionalized with a poly-lysine peptide for nucleic acid binding [85]. In another study, the F3 peptide and Lypl peptide (CGNKRTRGC) that targets lymphatic vessels of certain tumors, has been used to bioengineer a MaSp1-poly-lysine monomer to form nanocomplexes with plasmid DNA [86]. Modification of silk proteins that target human epidermal growth factor receptor 2 (Her2), overexpressed in 20'30% of invasive breast carcinomas, was also accomplished [65,87]. Two variants of tumor-homing peptides, H2.1 (MYWGDSHWLQYWYE) and H2.2 (LTVSPWY), were evaluated as fusions at the N and C termini to functionalize both MaSp1 and MaSp2 constructs [65,87]. Functionalization to impart mucoadhesive properties by the addition of Human Galectin-3 Carbohydrate Recognition Domain (hGal3), which specifically binds the mucin glycans Galβ1-3GlcNAc and Galβ1-4GlcNAc, produced silk materials that showed enhanced mucin binding properties compared to the wild-type [88]. One of the most complicated modifications described involves the delivery of DNA to the nucleus of stem cells. Variants based on MaSp1 spidroin contained a poly-lysine sequence, the nuclear localization sequence (NLS) of the large tumor (T) antigen of the Simian virus 40 (SV40), an hMSC high affinity binding peptide (HAB), and a translocation motif (TLM) of the hepatitis-B virus surface protein (PreS2) [89]. Finally, modifications to optimize the electrostatic interaction of spheres for lysosomal drug delivery has also been pursued. Here, spider tubuliform silk proteins genetically engineered using a 5xHis Tag to modify the isoelectric point of the recombinant protein showed enhanced drug release [66].

2.3. Elastin-like-protein recombinant protein polymers.

Elastin is an extracellular matrix (ECM) protein found in almost all higher animals with domains in various conformations bound through crosslinking [48]. The basic unit studied for drug delivery from ELP is a pentapeptide sequence -(GXGVP), where 'X' can be any amino acid except proline- derived from the elastomeric domain of mammalian tropoelastin [90]. ELP sequences are generally tandem repeats of the pentapeptide which also contributes to the viscoelastic properties of elastin combined with dynamic properties depending on the amino acid in 'X' position. ELPs separate from aqueous solution above the Tt where the phase separation of the polymer occurs [48,90,91]. This Tt is dependent on 'X' as well as on molecular weight, where the Tt decreases with increasing molecular weight [92].

Successful expression and purification of ELPs has been demonstrated using P. pastoris [68,93], while bacteria (E. coli) is the preferred system [92,94-96].

Modifications to the pentapeptide at the 'X' position is most common, while amino acids at other positions have also been modified. For example, substitution of the glycine in the first position to alanine resulted in a change of mechanics from elastic to plastic [48]. In natural elastin, 'X' is frequently valine, alanine, or isoleucine. Replacing a valine residue with a residue containing a side chain with different properties introduces strong reactivity to specific stimuli, including to changes in pressure, salt, pH, and electrical current [92,97].

ELPs generation as multiblock elastin-like recombinant polymers have been utilized for drug delivery and medical applications [94,95,98]. These block copolymers have been constructed by genetically linking a hydrophobic and hydrophilic block (i.e., [VPGIG]n1-[VPGSG]n2) or by adding a third hydrophobic end block.

ELPs have been engineered to incorporate peptides such as RGD [99] for cell binding or CPPs [100,101] to enhance endocytic uptake. CPPs peptides SynB1 [101], penetratin (RQIKIWFQNRRMKWKK), Tat (YGRKKRRQRRR), and MTS (AAVALLPAVLLALLA) [100] were fused to the N-terminus of ELPs. The penetratin-ELP fused peptide was further modified with the addition of a peptide derived from the cyclin-dependent kinase inhibitor p21 (WPGSGGRKRRQTSMTDFYHSKRRLIFSKRKP) [100]. Other modifications aimed to control physicochemical properties of the polymers like reducing aggregation of ELPs by adding polyaspartic chains [102], or modification of the degradation rate by adding sequences recognized by matrix metalloproteinases (MMPs) [103]. Further modifications include fusions of therapeutic peptides such as humanin [104], Vascular Endothelial Growth Factor [105], Bone Morphogenetic factor 2 [106], peptides that promote insulin release from pancreatic β-cells (glucagon-like peptide 1, GLP-1) [107], neuropeptide that promotes heart contractility and induces coronary vasodilation with therapeutic applications against hypertension (Vasoactive intestinal peptide, VIP) [108], and even a single-chain variable fragment [109]. To generate target-specific systems, ELPs have been functionalized with tissue specific peptides [105].

3.'Drug delivery system

3.1. Particle systems

Microparticles diameters usually range between 0.1 and 100 μm, while nanoparticle diameters usually range from 1 to 500 nm. Microparticle and nanoparticle systems have been widely used for controlled drug delivery owing to their large surface area, enhanced permeability and targeting ability [13,110]. Utilization of nanosized constructs suggest that poorly water-soluble drugs can be better administered via encapsulation, and diseased tissues can be targeted passively or actively[111,112]. Furthermore, with suitable targeting groups, macromolecular constructs can be delivered to intracellular sites of action. Targeting solid tumors using nanosized therapeutic constructs is often through the enhanced permeability and retention (EPR) effect. Due to the higher vascular density of tumor tissues and their lack of effective lymphatic drainage, macromolecular drugs can accumulate and be retained selectively without dispersing into healthy tissues [15,113-115]. The inverse temperature transition behavior of ELPs supports the retention of solubility in water under the critical transition temperature (Tt), while above the Tt, the polymeric chains hydrophobically fold and self-assemble into a more ordered structure suitable for drug delivery. Moreover, ELPs are biocompatible and do not generate immune responses as natural elastin analogs [116]. ELP nanoparticles were developed by thermo-responsive self-assembly for the sustained release of bone morphogenetic protein-2 (BMP-2) and bone morphogenetic protein-14 (BMP-14) over two weeks [117]. The nanoparticles were obtained by incubating the polymer solution at 37°C to yield particles ~238 nm diameter. The thermodynamically driven inverse phase transition of ELPs was used to design particles (300-400 nm) for the delivery of doxorubicin. During electrospraying, the solvent (water) rapidly evaporated to yield dehydrated ELP nanoparticles that could be controlled in size and morphology by adjusting the concentration and molecular weight of the protein [118]. ELP nanoparticles for drug delivery also present challenges, including the tendency to aggregate leading to larger structures, and they can have a critical transition temperature that is too low, factors that can lead to cell and organ damage. To prevent aggregation and increase the critical transition temperature, poly(aspartic acid) chains have been added to ELPs to obtain amphiphilic diblock peptides under 100 nm in diameter, with an critical transition temperature of ~37°C [102]. Following the same strategy, paclitaxel-loaded ELP-poly(aspartic acid) nanoparticles displaying EGF exhibiting active tumor-targeting capabilities were developed. The nanoparticles with a size of 30 nm successfully delivered the drug to HeLa cells, resulting in cell death[14]. To provide more control over the loading and the release of cargo, thermoresponsive crosslinked capsules were developed using microemulsion. The capsules, consisting of ELP and BSA, presented porous morphologies that could be tuned in terms of diameter and pore size by adjusting the ratio of ELP to BSA, with higher amounts of ELP leading to a more porous structures [119]. Porous structures of ELP microspheres were studied by adding albumin in different ratios and adjusting external stimuli; microspheres were obtained utilizing a water-in-oil emulsion and crosslinked with glutaraldehyde ( ) [120]. While the crosslinking provided control over the shape of the microspheres, the porosity of the structure was reversibly altered by changing the temperature and hence controlling the drug release profile. The size of the micropores was modified based on the mixing ratio of ELP. The thermo-responsiveness of the ELPs enabled pore opening and closing, whether the temperature was below or above its Tt, thus providing control over the release kinetics of drugs.

Open in a separate window

SLPs seek to build upon the strength and physicochemical properties found naturally in silk and further control those properties to achieve desirable performance in drug delivery. The most widely studied engineered SLP comes from either the B. mori silkworm or the spider N. clavipes. Engineered spider SLP complexes were designed with poly(L-lysine) domains to interact with plasmid DNA and and RGD to enhance cell binding. The size of the nanocomplex was tuned by adjusting the ratio of polymer to pDNA or the molecular weight of the poly(L-lysine) domains [84]. Changing the length of the lysine domain changed the size of the nanoparticles from 310 to 435 nm [80]. Moreover, a higher content of tumor-homing peptide was utilized to increase specificity and efficiency to home to tumor cells (MDA-MB-435 and MDA-MB-231), and smaller complexes ~90 nm diam. were obtained by changing the core recombinant silk domain to improve gene delivery ( ) [86].

SELPs consisting of a series of silk- and elastin-like proteins consist of a blend of mechanical and biological properties of both silk and elastin. While ELP offers elasticity, SLPs provide robust stability due to the crystalline β-sheets. This unique bifunctional class of protein is very useful for drug delivery as it is biocompatible, biodegradable and highly tunable in terms of mechanical properties and degradation lifetime, by changing the ratio of silk and elastin blocks [46]. Silk blocks tend to self-assemble into the core of micellar-like SELP nanoparticles, and the radius can be tuned by adjusting the ratio of silk to elastin [121]. Three different SELPs were generated to form doxorubicin-loaded micellar-like nanoparticles with radii between 50 to 142 nm, and they were uptaken up by HeLa cells ( ) [122]. Furthermore, by modifying the primary sequence of the SELPs, micellar-like nanoparticles (73-206 nm) with enhanced mucoadhesive properties for transmucosal drug delivery were achieved [123].

3.2. Gel systems

Cross-linked, 3D hydrophilic polymeric networks or hydrogels are potential candidates in tissue engineering, drug delivery, and for implant materials [125-127]. Interest in hydrogels arises from their facile fabrication, potential for injectability for noninvasive delivery, and useful interactions with biological materials. Properties of hydrogels such as high swelling ratios, porosity and soft consistency render them similar to natural living tissue, and thus good candidates for biomedical applications [128]. While naturally derived biomaterials can produce inconsistent or unwanted biological responses, the use of bioengineered proteins allows for tuning of mechanical and stimuli responsive properties, along with high purity and consistent molecular weight, avoiding negative outcomes. The crosslinking of hydrogels ensures these scaffolds are self-supporting and provide similar properties as the extracellular matrix (ECM) environment to support cell adhesion and gene expression. Hydrogels that are chemically crosslinked offer more mechanically robust and materials. Further, physically crosslinked hydrogels provide stimuli-responsive materials sensitive to environmental changes, including temperature, pH, and ionic strength.

ELP hydrogels also display mechanical properties similar to natural elastin, thus useful for tissue engineering. Moreover, utilizing ELPs for the formation of hydrogels provides thermo-responsive materials with tunable drug release due to the changes in structure by cycling the temperature above and below the Tt of the hydrogel. For example, reversible chemically crosslinked ELP hydrogels were obtained by introducing cysteine residues in the sequence and adding oxidative agents (e.g. ,hydrogen peroxide) to initiate disulfide crosslinking [129]. Adjusting the amount of cysteine provided control over the structure and thermal properties of the gels by altering crosslinking density and the Tt. ELP hydrogels were also prepared using ultrasonication to induce physical crosslinking without the use of chemicals, and the release of doxycycline at two different temperatures was demonstrated [130]. A higher release could be observed at the higher temperature (37 °C) compared to the lower temperature (25 °C) due to the change in porosity of the scaffold.

SELPs are capable of transitioning from aqueous solution to a physically crosslinked hydrogel using increased temperature based on the ratio of silk to elastin. While some SELPs are liquid at room temperature, they can form into hydrogels at body temperature. The effect of shear stress on SELPs demonstrated that more robust gel networks formed when compared to those not subjected to shear stress [131]. The shear stress created disruptions in secondary and tertiary structure from decreased intramolecular interactions and favoring more intermolecular bonds, hence to a stronger scaffold [132]. SELP hydrogels sensitive to MMPs for enhanced degradation in tumor environments were also developed [103]. Degradation rate was dictated by the location of the MMP-responsive sequence, thus useful for localized gene delivery. Mild oxidative conditions can also be used for the formation of chemically crosslinked SELP hydrogels with cysteine residues in the elastin blocks and disulfide crosslinking in the presence of hydrogen peroxide ( ). The release kinetics of those gels were tuned by the addition of a reducing agent (dithiothreitol) [124].

3.2. Solid formats

Solid carrier systems including films, wafers, reservoirs, foams and microneedles have been used for local and transdermal delivery due to the ease of modifications in terms of release kinetics, mechanical strength and size [18]. While bioengineered proteins are suitable starting materials for the fabrication of modular, solid delivery systems, limited use of protein-based materials has been developed to date. Thin films can be used on implanted devices to modify surface properties and facilitate integration with living tissues. For example, ELPs thin films containing sRGD were pH and thermo-responsive to provide tunable surface properties like wettability and topography [99]. Thin films are also ideal for optical applications for sustained drug delivery and bioavailability [133]. Chemically crosslinked films using glutaraldehyde were initially developed, but the transmittance of visible light was only 77%, while 95% was achieved with methanol induced physical crosslinking ( ) [134]. These SELP-based thin films were also used for the delivery of ciprofloxacin related to crystallization and kinetic release profiles. The films treated with methanol had slower release compared to ethanol due to the increased physical crosslinking density and enhanced stability [133].

Open in a separate window

Electrospun fibers are attractive for biomedical applications as they have similar morphological features as the ECM. The fibers can be used in wound dressings, as antibacterial materials and for drug delivery [135]. Using bioengineered proteins allows aqueous processing and simplifies the manufacturing while diminishing possible toxicity from residual solvent [136]. SELP-based fibers in aqueous solution without the addition of any surface modifying agents resulted in the formation of ribbon-like morphologies with self-standing and non-woven fiber meshes ( ) [137]. The diameter of the fibers ranged from 25 nm to 1.8 cm by varying the concentration of the SELP solution prior to electrospinning.

4.'Biomedical Applications.

DDS that can improve the therapeutic index for a drug will ultimately lead to better patient outcomes. Recombinant proteins provide an excellent option for the development of DDS due to their precise molecular structure, tunability, and the range of physicochemical properties. SLPs [34,82,84,87,88,138,139], ELPs [140-146], and SELPs [51,147-152] have been utilized as drug carriers in many successful applications. The ability to finely tailor the protein structure and chemical composition makes them amenable for a variety of therapeutic options including small molecule drugs [153-157], biologics [158-162], and gene therapy systems [32,86,163-165].

ELPs were used for treatment of glioblastomas, an especially aggressive form of cancer [101]. Despite numerous efforts to develop DDS targeted to this cancer, patient outcomes remain dire. ELP systems that killed glioblastoma cells selectively and effectively were developed using temperature-responsive properties for the aggregation and accumulation of the DDS in tumor cells at a specific temperature above physiological condition. Additionally, a cell penetrating peptide (CPP) was incorporated into the ELP to facilitate efficient uptake of the DDS into the cell. Finally, an acid sensitive linker was used to conjugate doxorubicin (Dox) to the carrier ( ). This permits selective release of Dox once the DDS enters tumor cells and is exposed to decreased pH. The CPP was integrated into the ELP carrier via genetic fusion, removing the need for further functionalization or chemical conjugation. Additionally, the incorporation of the acid sensitive linker and the drug molecule was achieved in a highly selective and predictable manner by thiol-maleimide coupling to three cysteine residues on the ELP. This precise stoichiometric control enables a reliable and quantifiable measure of drug conjugation. A composite material formed from hyaluronic acid (HA) and dendritic ELP was also shown to release drug in a controlled fashion [16]. In this example, lysine terminated dendritic ELPs formed hydrogels via HA crosslinking using EDC coupling. The selective crosslinking sites provided by the ELPs allowed for control over crosslink density and enabled the controlled uptake and release of the model drug system dependent on hydrogel composition. SELP drug carriers were also designed using a block copolymer system that facilitated efficient micelle formation upon addition of a hydrophobic drug, while simultaneously enabling enhanced loading of the drug into the micelle core [166]. Using recombinantly produced constructs, varying SELP ratios were efficiently tested to determine the optimal composition for drug uptake and controlled micelle formation. Doxorubicin was used to trigger SELP micelle formation, and effective cell uptake and apoptosis was observed in HeLa cells indicating a promising system for tumor treatment and therapeutic delivery. Each of these examples demonstrates the advantages of recombinant polypeptide structures for drug carrier development.

Recommended article:
Effective Peptide Delivery Systems: Enhancing Targeted Therapy and Drug Absorption
Key Benefits of Hospital Bed Safety Rails Explained

The company is the world’s best hydrolyzed fish collagen exporter supplier. We are your one-stop shop for all needs. Our staff are highly-specialized and will help you find the product you need.

Open in a separate window

Proteins and peptide therapeutics often prove challenging to deliver due to their size and stability, complex structures, and susceptibility to enzymatic degradation. However, several examples of recombinant protein-based systems have been presented showing successful delivery of key protein therapeutics. For example, protein fusions for delivery of humanin, a crucial peptide required in the protection of human retinal pigment (RPE) cells in diseases such as macular degeneration, was demonstrated [104]. A temperature responsive ELP was fused to humanin to generate a stable DDS that showed binding to RPE cells under physiological conditions and demonstrated protection against oxidative stress that otherwise leads to apoptosis. In a similar fashion, a SELP fusion system was developed for the delivery of vascular endothelial growth factor (VEGF) a widely employed treatment of kidney disease [105]. To further functionalize the drug delivery system, a kidney targeting peptide was added, creating a chimeric protein to improve uptake in kidney tissue and reduce unwanted tissue accumulation. The DDS showed increased localization to the kidneys and decreased off target tissue deposition compared to the ELP construct without the targeting peptide ( - ). This system successfully maintained the therapeutic efficacy of VEGF while facilitating renal tissue deposition. An ELP fusion delivery system was also generated for bone regeneration applications [106]. Bone morphogenic protein 2 (BMP2) was genetically incorporated into an ELP sequence resulting in a stable construct that retained the therapeutic efficacy of BMP2, as well as the temperature responsive features of the ELP. Testing of this ELP system in a mesenchymal stem cell model resulted in osteogenic differentiation, indicating the potential for use in bone healing. Nanoworm complexes consisting of an ELP domain functionalized with a single chain variable fragment (scFv) of the antibody therapeutic Rituximab were developed [109]. The use of the ELP fusion enabled an increase of therapeutic efficacy compared to the antibody alone due to the multivalent nanostructures which bind efficiently to CD20 receptors on two different B-cell lymphoma cell lines and induce apoptosis. In vivo experiments also showed an increase in efficacy of the protein polymer hybrid structures compared to the antibody drug alone. The utility of recombinant engineering is seen in this method, as the antibody structure was efficiently incorporated into the nanoparticle system without the need for typical bioconjugation strategies requiring additional chemistry and purification steps.

Open in a separate window

Another rapidly evolving area of therapeutic development is gene therapy. Recombinant protein-base DDSs provide a novel approach to generate non-viral vectors for the delivery of genetic material. One such example can be seen in a nanoparticle delivery system developed with low immunogenicity to enable prolonged circulation and ultimately improve tissue uptake and therapeutic efficacy of plasmid DNA [167]. ELP constructs functionalized with a DNA condensing domain (RH3), which facilitates efficient packaging of plasmid molecules with the ELP chains, were applied to fabricated nanosized particles. When compared to pegylated delivery methods, the ELP nanoparticles showed significantly decreased immune responses and increased efficiency of plasmid delivery. This example highlights the biocompatibility of protein-based DDS, as well as the facile functionalization afforded by genetic engineering. In an elegant design of SELPs modified with matrix metalloproteinase (MMP) responsive sequences, the controlled delivery of viral particles for cancer therapy was validated [103]. Through addition of MMP cleavable domains along the protein backbone, degradation of the SELPs could be tightly controlled. Tunable degradation rates dependent on location of the MMP sites were demonstrated, and this feature was further illustrated in in vivo mouse models of head and neck squamous cell carcinoma where the SELP DDS significantly improved delivery of adenoviral vectors ( - ). The usefulness of genetically engineered non-viral vectors was further established in a design of elastin-like recombiners (ELRs) for gene delivery [164]. ELR fusions incorporating penatratin and LAEL fusogenic peptide sequences (i.e. domains of Leu, Ala, Glu, and Leu) to facilitate cell uptake of the DDS and increased transfection levels of plasmid DNA were created using ELRs with cationic backbones for efficient complexation of plasmid DNA resulting in stable polyplexes. This was accomplished through modification of the elastin variable position to contain lysine residues. Peptide sequences were added using recursive ligation, which allows for control over the resulting polymer structure, size, and charge. In C6 rat glioma cells the constructions with the LAEL motif showed the highest transfection efficiency. Further application of SELPs as DNA carriers was also exemplified in SELP hydrogel systems [168]. Hydrogels fabricated from SELPs, generated with tunable degradation properties and temperature-responsive gelation at 37°C, displayed precise spatial and temporal control over adenovirus delivery indicating potential utility in head and neck cancer therapies. The SELP hydrogel demonstrated a 10-fold increase in gene expression upon intratumoral injection compared to the viral injection alone.

Open in a separate window

5.'Conclusions

The need for new and refined therapeutics has led to the development of polymeric drug delivery systems to improve the therapeutic outcomes and diminish unwanted side effects. While much research has been focused on synthetic polymers, their limitations in terms of chemistry, tunable control of structure and mechanics, limited aqueous processing, bulk hydrolysis and production of acidic byproducts has drawn more attention toward natural polymers. Naturals proteins have been engineered to provide tunable features rendering them stimuli-responsive or allowing for the fabrication of disease-targeted DDS. ELP and SLP recombinant protein systems and their implementation in the field of drug delivery, as reviewed, are summarized in . Such bioengineered protein polymer systems offer precise tailoring and control that is useful in envisioning future needs with specialized or selective DDS. In particular, compatibility with complex proteins, peptides, and assemblies, tunable features related to targeting, degradation and stability, biocompatibility and safe degradation products, are some of the key values of these systems that can be achieved while maintaining the mechanical value of elasticity of natural elastin and robustness of natural silk. When combined with options to directly encode target sequences, therapeutics and related control points during design and fabrication of DDS, new avenues are realized for bioengineering protein polymers in the field of DDS. The high customization level and attractive physicochemical properties of such engineered proteins make them suitable candidates for drug and gene delivery. Despite the numerous advantages of engineered proteins, challenges remain with clinical translation. No ELP or SLP carrier has yet received clinical approval for drug delivery. Nevertheless, various ELP fusions have successfully completed phase I and II clinical trials: VIP-ELP (Vasomera') for the treatment of pulmonary arterial hypertension, cardiomyopathies and cystic fibrosis completed phase I; and GLP1-ELP (Glymera'), for the treatment of type II diabetes completed phase IIB. These clinical trials demonstrate that ELPs are tolerated in humans and do not induce a significant immune response [169-171]. With the advent of personalized therapeutic modalities, recombinant protein systems, such as those presented in this review, should continue to grow in importance and implementation in the field, providing an advanced platform for modulating DDS to optimize patient outcomes.

Table 3.

StructureSequence ModificationsMaterial FormatApplicationsReferenceSilkworm silkGAGAGSElastin G

X

GVP
X is any amino acid except ProNanoparticlesDrug delivery (doxorubicin)[140,161,162]Elastin G

X

GVP
X is ValineHydrogelsGene delivery[160]Spider silkPoly-lysParticles (pDNA complexes)Gene delivery[20,73]ECM peptides (RGD)
Cell penetrating peptidesParticles (pDNA complexes)Gene delivery[77]Tumor-homing peptidesParticlesGene delivery[78,79]Nuclear localization sequence and translocation motifsNanoparticlesDelivery of Cy-5-labeled pDNA[82]ElastinG

X

GVPX is ValineNanoparticlesDelivery of bone morphogenic proteins[108]X is ValineHydrogelsDelivery of antibiotics and proteins[120]X is any amino acid except prolineNanoparticles, microgelsDelivery of Doxorubicin, rhodamine[109,111]X is LysineMicrospheresDelivery of BSA and prednisone acetate[112]X is polyaspartic acidParticlesDelivery of hydrophobic fluorescent molecules[95]Bioengineered with polyaspartic acidNanoparticlesDelivery of Paclitaxel[110]X is Valine
Bioengineered with VEGF and kidney-targeting peptideSoluble proteinDelivery of VEGF in kidney[98]X is AlanineNanoparticlesDelivery of antibody Rituximab[100]Open in a separate window

Acknowledgements

The authors thank Dr. Francisco Carrillo-Salinas for his contribution in the graphical abstract and .

Funding: This work was supported by the National Institutes of Health [P41EB, R01NS, U01EB], the Air Force Office of Scientific Research (FA-17-1-) and the Army Research Office (W911NF-17-1-). Special thanks to Ralph Parchment, Ralph regarding helpful discussions in translational aspects of the proteins with respect to the NIH NCI (contract HHSNE).

Footnotes

Publisher's Disclaimer: This is a PDF file of an unedited manuscript that has been accepted for publication. As a service to our customers we are providing this early version of the manuscript. The manuscript will undergo copyediting, typesetting, and review of the resulting proof before it is published in its final form. Please note that during the production process errors may be discovered which could affect the content, and all legal disclaimers that apply to the journal pertain.

The best peptide products for skin, according to experts

Retinoids have long been popular for their ability to both speed up skin cell turnover and stimulate collagen production, contributing to firmer, smoother skin over time. But they can come with some uncomfortable drawbacks, including dryness and flakiness ' especially for those with sensitive skin. One alternative that doctors recommend is peptides. Not only are they generally gentle, but they can offer a wide variety of benefits for skin. Depending on the type of peptide(s) in your skin care, they can help smooth fine lines, soften wrinkles and even improve skin barrier function, without the drawbacks that come with other ingredients, such as retinoids.

To help you choose the right products with peptides, we spoke to three board-certified dermatologists about what to look for in a formula and who should be using them.

SKIP AHEAD How we picked the best peptide products | The best peptide products of  

What is a Peptide?

Peptides are naturally found within skin. For context: Amino acids are the building blocks in the body. A chain of amino acids is a peptide, and a chain of peptides forms a protein, according to New York, NY-based board-certified dermatologist Gloria Lin, M.D. Peptides are involved in many different functions in skin, including stimulating tissue production and supporting wound healing, according to Lin. 

How we picked the best peptide products

The best peptide products can address various skin concerns and fit into different steps of your skin care routine, depending on the formulation and exact type of peptides. Here's what to consider when you're shopping:

  • Types of peptides: Manufacturers use four types of peptides in skin care, and they work in different ways within skin to carry out different functions (like relaxing muscles and encouraging collagen production).
  • Other ingredients: Peptides pair well with hydrating ingredients, antioxidants and retinoids. These can complement their benefits.
  • Product category: You can find peptides in cleansers and masks, but they're most effective in formulas that remain on your skin, such as face serums and moisturizers.

The best peptide products of

'This cream employs a novel approach by delivering a high peptide concentration deep into the skin, making it impactful in reducing wrinkles and lines,' says Danilo Del Campo, M.D., a board-certified dermatologist in Chicago, IL. The lightweight formula has two types of peptides: Messenger peptides instruct cells to create more collagen and elastin, while neuropeptides minimize muscle movement to smooth the appearance of lines, according to the brand.

This face cream is a go-to for Lauren Fine, M.D., a board-certified dermatologist in Chicago, IL. 'It's super easy to use and not drying or irritating,' she says, noting that it also layers nicely beneath sunscreen and makeup. It has antioxidants to defend skin against environmental aggressors, as well as a peptides that can restore volume to skin and help create and maintain new collagen and elastin, according to the brand.

Del Campo says this line is a good option 'for those seeking cost-effective and potent peptide formulations that are suitable even for sensitive skin.' Billed as an alternative to retinoids, it also has niacinamide and panthenol to help brighten and condition skin, respectively, according to the brand. It's also hypoallergenic and fragrance-free.

Lin likes that this formula has six signal peptides, all of which work to stimulate collagen production. On top of that, she says, it also has hyaluronic acid to improve hydration.The fragrance-free formula will also sink into skin quickly and can address fine lines like crow's feet, according to the brand.

This serum has it all, counting omega-3 fatty acids, antioxidants and a brightening peptide to improve the skin barrier and even out skin tone, according to the brand. It's a good option if you find other ingredients to be too irritating, says Fine. 'Products that contain both peptides and antioxidants can be ideal for people who have dry or sensitive skin and cannot tolerate acids or retinoids in their daily routine,' she says.

This formula has a 30% concentration of 10 different peptides, as well as hyaluronic acid for hydration and plump skin in the short term, according to Lin. 'It does contain copper peptide and carnosine, so it can be helpful for collagen production, wound healing and protection against free radical formation,' she says. You can use it morning and night, and it works well when you pair it with retinoids, according to the brand.

This is a favorite of both Fine and Dr. Gabriela Soza, a board-certified cosmetic dermatologist at Wexler Dermatology in New York City, who uses it in her own routine. Fine likes that in addition to using both growth factors and peptides, it's 'excellent for maintaining a healthy skin barrier and hydration,' she says. It also targets both fine lines and uneven or dull skin tone, according to the brand.

Ideal for dry skin types, this serum uses hyaluronic acid and squalane to add additional hydration to skin and offer a plumping effect, making it a favorite of Lin. Plus, she says, 'the copper peptide helps with collagen and elastin production.' You can use it morning and night, but keep in mind that it doesn't pair well with vitamin C or alpha hydroxy acids, as these will reduce the efficacy of the peptide, according to the brand.

Peptides can be an investment, but this formula comes at a more approachable price point, says Lin. It also uses 'five different peptides, including a copper peptide, to help stimulate the production of collagen and elastin,' she says. It also has hyaluronic acid and amino acids, and you can use it twice a day.

Lin likes that this formula uses lactic acid alongside signal peptides, saying that the acid can enhance the penetration of those peptides into skin. However, it 'might not be suitable for more sensitive skin types due to the lactic acid,' she says. 'This can be drying and irritating.' It also has hyaluronic acid, squalane and marula oil, and the formula is vegan, cruelty-free and fragrance-free.

Frequently asked questions

Peptides serve as the messengers between skin cells. 'They instruct cells to execute various vital tasks that ensure optimal skin health and appearance,' says Del Campo. In topical formulations, peptides masquerade as those naturally present in our skin ' and in doing so, trigger reactions, like boosting collagen production or speeding up skin repair. Ultimately, they have the 'capacity to sway biological processes,' he says.

That becomes all the more important with age. Not only do our natural levels of peptides dip, but so does the integrity of our collagen and elastin. 'Collagen and elastin are essentially what gives skin structure, support and its ability to 'bounce back',' says Fine. In spurring more production of these proteins, peptides are able to offset this.

That said, they're not a one-trick pony. 'Certain peptides also possess anti-inflammatory characteristics, which can help calm skin and lessen redness,' says Del Campo. Others, meanwhile, may fortify skin barrier function, allowing for better hydration and protection from environmental stressors, he says.

There are four primary types of peptides, according to Lin:

  • Signal peptides trigger 'signals' to cue cells to carry out certain actions, like producing collagen and elastin.
  • Carrier peptides deliver ingredients into the skin, where they can offer their benefits deep within skin.
  • Enzyme-inhibiting peptides can slow or stop enzymatic reactions, such as those that contribute to the breakdown of collagen.
  • Neurotransmitter peptides block the release of chemicals related to muscle contractions, which are involved during wrinkle formation.

That said, these are not equally powerful. As of now, only signal and carrier peptides have the scientific literature to back up their efficacy in skin care products. And while they're promising, 'more research needs to be done on enzyme inhibitor and neurotransmitter peptides in patient studies to determine its true effectiveness,' says Lin.

For one, most people can use peptides (unless you have some sort of allergy, which isn't common). While retinol can be associated with dryness and irritation, peptides tend to be more gentle and tolerable, says Lin. For that reason, peptides may be better for those who have dry or sensitive skin ' and are a worthwhile retinol alternative.

However, the advantage of retinoids, a class of vitamin A derivatives that can stimulate collagen production and speed up cell turnover, is that they have decades of research to back up their efficacy. And despite the promising nature of peptides, they still merit more research, says Del Campo. 'For instance, the exact methods by which various peptides impact skin cells at the molecular level is not entirely clear,' he says. 'Moreover, the long-term impact of peptide usage lacks comprehensive documentation. More research is needed to understand how peptides interplay with different skin types and conditions over time.' Their overall stability and efficacy in penetrating skin to reach specific targets is also a little unclear at the moment.

For that reason, instead of adding a peptide product to your routine and calling it a day, the best scenario might be to use one consistently with other products like sunscreen, retinol and vitamin C, says Lin.

While most other skin care products work well alongside peptides, the exception is alpha hydroxy acids (which includes glycolic acid, lactic acid and mandelic acid, among others). These can render the peptides less effective and interfere with results.

That said, there are certain products that pair these ingredients together; if that's the case, they may be formulated in a way that avoids this issue.

How to shop for skin care products with peptides 

When shopping, keep in mind that different peptides execute different functions in skin. The two most common types of peptides in skin care formulas are signal and carrier peptides, says Lin. 

'Signal peptides could include palmitoyl tripeptide, tetrapeptides, pentapeptides, and hexapeptides, along with carnosine, which also has antioxidant properties,' she says. Meanwhile, carrier peptides include ingredients like copper tripeptide and manganese tripeptide. They can usher other actives where they're needed for collagen and elastin production, wound healing and other benefits.

Pairing peptides with other active ingredients can also amplify their benefits, says Del Campo; these include antioxidants, and hyaluronic acid, a humectant that draws water into skin. 'Pairing peptides with hydrating substances can enhance moisture levels, while antioxidants provide protection against environmental damage,' he says. He also recommends using them alongside ceramides and niacinamide; the three can work together to fortify the skin barrier.

Finally, Lin recommends seeking out peptides in serums and moisturizers, as they 'may have superior penetration,' she says. 'These have prolonged contact with the skin compared to cleansers or other products that are meant to be washed off.'

Meet our experts

At NBC Select, we work with experts who have specialized knowledge and authority based on relevant training and/or experience. We also take steps to ensure all expert advice and recommendations are made independently and without undisclosed financial conflicts of interest. 

  • Danilo Del Campo, M.D., FAAD, is a board-certified dermatologist in Chicago, IL, whose specialities include cosmetic dermatology and medical dermatology.
  • Gloria Lin, M.D., FAAD, is a board-certified dermatologist at Schweiger Dermatology in New York, N .
  • Lauren Fine, M.D., FAAD, is a board-certified dermatologist in Chicago, IL, whose research interests include adult female acne, acne scarring and hair loss.

Why trust NBC Select?

Deanna Pai is a freelance beauty writer and editor who has been covering beauty and health for more than a decade, including topics like curl types and vitamin E. For this article, Pai spoke to three dermatologists to narrow down the best peptide products to shop, and highlighted their recommendations about what to consider when shopping.

Catch up on NBC Select's in-depth coverage of personal finance, tech and tools, wellness and more, and follow us on Facebook, Instagram, Twitter and TikTok to stay up to date. 

If you want to learn more, please visit our website hydrolyzed fish collagen manufacturers.

Comments

0

0/2000